PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN39709.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 273aa    MW: 31276.2 Da    PI: 6.2545
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN39709.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.66.7e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l + +   G ++W+t+++  g+ R++k+c++rw +yl
       KHN39709.1 14 RGPWTIEEDHKLMNFILNNGIHCWRTVPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding51.81.9e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T+ E++++++++  lG++ W++Ia++++ gRt++++k++w++
       KHN39709.1  67 RGGFTEMEEDQIIQLHSCLGNR-WSKIASHFP-GRTDNEIKNHWNT 110
                      788*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-21564IPR009057Homeodomain-like
PROSITE profilePS5129413.486961IPR017930Myb domain
SuperFamilySSF466891.95E-2811108IPR009057Homeodomain-like
SMARTSM007172.4E-61363IPR001005SANT/Myb domain
PfamPF002497.7E-121461IPR001005SANT/Myb domain
CDDcd001671.85E-41661No hitNo description
PROSITE profilePS5129423.7962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2465116IPR009057Homeodomain-like
SMARTSM007175.1E-1566114IPR001005SANT/Myb domain
PfamPF002491.1E-1467110IPR001005SANT/Myb domain
CDDcd001673.88E-1070110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MGRQPCCDKV GLKRGPWTIE EDHKLMNFIL NNGIHCWRTV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGGF TEMEEDQIIQ LHSCLGNRWS KIASHFPGRT DNEIKNHWNT KIKKRLKLLG  120
LDPLTLKPSE QKEKSVDDKK NIELQPNTSK GSEQGVENKS LDMHSTSEVP KTEGKIEENK  180
VTWDDTTGFF NNYEMLCSQL DLGSWMSQET KTSTSSYCSS SFSLDDSSNL SVGESSYLQE  240
NSLQQWVDGL DSILSWDSFN PLEKDFLFLD NSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-140AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555012.10.0PREDICTED: myb-related protein 315-like
TrEMBLA0A0B2S6010.0A0A0B2S601_GLYSO; Myb-related protein 315
STRINGGLYMA19G07830.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66253150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.17e-78myb domain protein 40
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]